DPCstruct | MC39059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 134 ± 7 aa |
| Standard deviation of domain lengths | 6.72 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 48.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q7RR69 | 3-142 | DQQEILPLWEEKAQLSSLSQLLTLMKPSSLRQYLGSETLPPCWEQQPKASAELDHKVCYLCYSLLTLAGVVVSCQDITPDQWGDLQL… |
| A0A821RD83 | 236-372 | NCKYVPLDYDSQMLLLCRLMSEMRPSSLARKMETDPENISKTSAELDQEAYYLTFSLLNLVNDASISDEPPFIQRKYILKLCTELEK… |
| A0A3Q7S140 | 74-200 | None |
| H3CTE1 | 10-141 | None |
| A0A5N4DHY7 | 2-128 | None |
| A0A2Y9QBK3 | 17-156 | None |
| A0A6P8QLD7 | 742-883 | None |
| A0A6J2LVS8 | 155-294 | None |
| A0A6J0SHT8 | 879-1001 | None |
| A0A2K5TU37 | 16-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.