DPCstruct | MC39054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 127 ± 14 aa |
| Standard deviation of domain lengths | 14.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R1PA28 | 2-109 | IDFIFDYQVPINDGYPLLPRDEAYFQFKCIQKRRCLICGRAADINHIDEVGMGRNRNKLDHTQARLSALCRVHHTEFHQIGYQMFCK… |
| A0A2G9EFV8 | 109-229 | TLTQNQANDLVKWLLETCIYYDVPLKMDIENLADQYDKAYHYVCLKNKFCCICGKSDGVLHHYDNVARIGGYKFDDGRVLRVMCLCG… |
| A0A0R2B920 | 21-149 | None |
| A0A2J6P2E1 | 78-206 | None |
| A0A0R2CDX9 | 15-140 | None |
| U2SUP7 | 92-225 | None |
| A0A2A7QY00 | 73-207 | None |
| A0A7U8IN02 | 19-125 | None |
| A0A4R8H3K4 | 148-289 | None |
| D1AR23 | 94-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.