DPCstruct | MC3905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 57 ± 6 aa |
| Standard deviation of domain lengths | 6.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 57.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0261 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7FYW6 | 42-94 | GKKGVWLKVPADRTELVPVSIDLGFELHHAEKAYIMLNMWLPSTASQLPANAS |
| A0A4Y7K8B4 | 80-132 | VYPEDGKKGVWLKLRLDRSELVPVAVKGGFKYHHAEEGYLMLTYWIPEGPCML |
| A0A0D3DM40 | 35-101 | None |
| A0A4W3HW20 | 28-84 | None |
| A0A0R0I239 | 114-167 | None |
| A0A2P6NNP2 | 65-119 | None |
| A0A5N5IS59 | 253-307 | None |
| A0A067KNC4 | 107-155 | None |
| A0A4D6LIJ9 | 47-105 | None |
| A0A5A7PJ10 | 65-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.