DPCstruct | MC39047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 201 ± 25 aa |
| Standard deviation of domain lengths | 24.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 31.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9IY89 | 320-521 | FMAVRILEGGEGNVREGEERIVKELIVEVVDSRTKKPFLGGLCNKGTGVEYHHACSQTQPYTPRVPPQNQSHRVTQTVQYRTKEQNT… |
| C1E0T6 | 205-408 | LANTDAPSSLPETLRVTVRGARRGEPSRVVTVRIDASGCVKPRYLGGFRDRRDGTVYHHASNQTIPTKPRVWKTKFTTETQTAQGRS… |
| A0A812WGR8 | 218-420 | None |
| A0A7S1QQ64 | 85-275 | None |
| A0A1X7T298 | 98-320 | None |
| A0A0X3Q1P3 | 94-295 | None |
| A0A7S0VK68 | 1-257 | None |
| A0A232F3L1 | 11-171 | None |
| A0A7J7AWD1 | 414-610 | None |
| A0A195BBT4 | 1-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.