DPCstruct | MC39039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 123 ± 15 aa |
| Standard deviation of domain lengths | 14.63 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14087 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A552ZRK2 | 2-122 | TTTGYVLAGLLAVAIIVIGVRFLVAPAVAAAGYGVPTDADRPDVRAYLSVKGLRDISTGVIVIVLIAAHATHLVGWAMLAATIIPLG… |
| A0A6N7HE20 | 67-184 | ADILTALGGLGIVFIGLRYVLAPYASAATFGLPDWPREAFRSWLNLKGVRDIGIGLLTLTMLVVASPTTLAWFVLVTALIPAGDMLV… |
| M2MWI4 | 8-139 | None |
| A0A5N5NK32 | 1-180 | None |
| A0A4D4N789 | 35-138 | None |
| A0A0F8WTY0 | 5-127 | None |
| A0A5N6KU92 | 7-126 | None |
| A0A1H1CKN4 | 6-121 | None |
| A0A6A6PIW5 | 10-141 | None |
| A0A6A6PTQ3 | 8-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.