DPCstruct | MC39028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 138 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Standard deviation of domain lengths | 10.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.34 |
| Pfam Score | 98.64 |
| Assigned Pfam label(s) | CL0041- CL0661- CL0027 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B5Q9L2 | 1-94 | MALKQMLFETLQELGDEEFRRFKWFLQQTDDLDGLPLIPKSHLENADRQETVDQMVQKYNCWAVEVLKKNLQKIYRNDLQDKLSNIH… |
| A0A1S3L4N6 | 10-97 | TGTTTNVSYLLLGALAELVSEELEIFQWNLNHGVEGFTSIPRGQLENANRLVTVNRMVQQYHEDGAVKITLEILGKMGQNKLAHELEK |
| A0A2I4ALM6 | 2-91 | None |
| A0A1S3M092 | 3-97 | None |
| A0A1S3M771 | 2-101 | None |
| A0A1S3MS71 | 1-91 | None |
| A0A6I9YE77 | 20-121 | None |
| A0A3Q3FV00 | 7-102 | None |
| A0A6J2RBY8 | 9-91 | None |
| A0A5J5D2Z5 | 2-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.