DPCstruct | MC39022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 112 ± 15 aa |
| Standard deviation of domain lengths | 14.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4M4K9 | 2-110 | FNEGLSTRRAAYIMFPQAVPRKAVIDPSICLYLTRKTCRVCEKFCPAQAINWNDTEKVISINVDAVIVATGYKFVDPRHPALSAYGW… |
| A0A7C4EU86 | 55-176 | PTKVPNEFNFGLDMRKAIYKDYAQGIPSVYTIDPQHCKVLTGGKCGVCAKVCQAKAIDYEQKDSEVELNVASVIVSTGYELFDATQI… |
| A0A0F9K2B3 | 43-175 | None |
| A0A523UXR6 | 148-255 | None |
| A0A7C4M9P0 | 253-375 | None |
| A0A351CFC5 | 17-132 | None |
| A0A661JHS2 | 159-252 | None |
| A0A532UDE0 | 55-142 | None |
| A0A2T0AMY9 | 55-182 | None |
| A0A6V8NR86 | 225-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.