DPCstruct | MC39020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 117 ± 11 aa |
| Standard deviation of domain lengths | 11.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C6MDK8 | 1-107 | MSSVEKLFEYGKTILTETELQQVIKETDYGLFHHVVETLVDDGILVPVKSSGLNGRLPPLFNKYRIIKPKEDFSGYFESIRHLNPAL… |
| A0A7C6ULW9 | 5-132 | KRIISFLKTYKKRTIPLSDLEQQIKENVDYSVFVSTIQGLTDKQILLPVKSHGTNGKSHPLFNTYRIIKANLRESLNSEIQSYSIMV… |
| A0A261F010 | 37-139 | None |
| W4V985 | 1-127 | None |
| A0A6N8CRV3 | 1-113 | None |
| A0A0B7MNH7 | 19-154 | None |
| A0A3D0WZS9 | 6-110 | None |
| U2ERR1 | 13-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.