DPCstruct | MC3902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 56 ± 3 aa |
| Standard deviation of domain lengths | 2.88 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 35.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B0SV77 | 3-55 | ESECVECGGTVALHDDLEIGEIVDCETCGAELEVVDVSPPVLDRAPELEEDWG |
| A0A0S7Y3S2 | 1-61 | MPKSAKCPECGAKVTIDEYIEEGEMVFCEECGVGLKVTSLRPIRLEVEEEEKTNEGIEDTY |
| A0A7C6ZT03 | 1-53 | None |
| A0A7C6XKB2 | 3-59 | None |
| A0A257AZW7 | 30-88 | None |
| A0A3M1FS10 | 115-169 | None |
| A0A1V2RDE3 | 267-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.