DPCstruct | MC39019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 165 ± 27 aa |
| Standard deviation of domain lengths | 27.04 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8RCF5 | 2-168 | PRLDLKPRPLYEAEGLSLLKTHYYGGIKKYQWLAIPLALHGVIVKKDGSQVLVQLGEDENDLVFTIADLLPHLAKEQMEQKMVDAIK… |
| U3IZ12 | 482-635 | VKRRSKRGQVGMVQVGVETYGGGIWNTWFDRDLTVAGRVIVKEPSTGRLEQRLVHVERPVLRIPHLAIHLQRSVNESFGPNTEHHLV… |
| A0A0G4NI22 | 128-311 | None |
| A0A814T4X9 | 96-251 | None |
| A0A2H6KB02 | 102-238 | None |
| A0A0B7NG15 | 144-293 | None |
| A0A840UPS1 | 86-241 | None |
| A0A3F2RQR7 | 658-804 | None |
| A0A5N5WJR0 | 529-681 | None |
| A0A6S6UXD9 | 218-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.