DPCstruct | MC39016
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 136 ± 14 aa |
| Standard deviation of domain lengths | 13.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E9NA74 | 124-271 | FMESEADLDAEIKGLTILGETPELFSEFVKLGCIRSLVNLLAHENTDIAIDVVEVLRELTDEDTDAADEDMKALIDALMEAEIMDML… |
| V9IG06 | 1-122 | MVELGAVPSLLELLSHENTDIAVGVVDLLQELTDVDILHESQEGADTLIDALLEQQVCALLVQNLERLDESVKEESDGVYNTLAIFE… |
| A0A7R8X0T1 | 451-583 | None |
| A0A482T2Q4 | 19-186 | None |
| A0A6H5G3G0 | 15-164 | None |
| K3YPW5 | 78-205 | None |
| A0A7S0DS40 | 111-239 | None |
| A0A0V1L773 | 504-636 | None |
| A0A158Q3E8 | 1278-1396 | None |
| G7L9V9 | 51-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.