DPCstruct | MC39015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Standard deviation of domain lengths | 5.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 65.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445CU17 | 51-127 | VRQVELMKKEKDKHRNELKLKTGDGLLDFLVQQKIKDRDVSLCPRCNAVFDAKAAVIFEKERMKKELAHREEQARQR |
| A0A444Y452 | 1-82 | MVSISYDFDEALDDFESQVRSIYPQAGDSLLDFLVQQKIKDRDMSLCPRCNFVFDDEAAAIFEKKRMKKELAHREEQARQRQ |
| A0A445BS96 | 9-92 | None |
| A0A445BIR0 | 1-89 | None |
| A0A445B706 | 34-102 | None |
| A0A445CH30 | 1-89 | None |
| A0A445CAB4 | 172-253 | None |
| A0A444Y255 | 123-206 | None |
| A0A445AJ81 | 1-80 | None |
| A0A445BTL1 | 36-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.