DPCstruct | MC39014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 277 ± 22 aa |
| Standard deviation of domain lengths | 22.32 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7F664 | 1-286 | MQQYDVHLAQSMENGLHYMAVAFAMQLVKLLLVDDRSVSHVTEADLFQTIEILMRTCAHSRANAPEGLPQLMDVVRSNYEAMIDRAH… |
| A0A820WC83 | 729-1002 | IRQIDVQMSQLIDSGSNSALHFAVNFLRSCVIEQPCCSDNDIPLILDSLHRISLIGKQPAEAVRDLLEIIRLNYTSLTDSNENKIDK… |
| A0A820WJY6 | 444-714 | None |
| F6GV61 | 101-390 | None |
| A0A835HAP9 | 17-260 | None |
| A0A287Q226 | 106-373 | None |
| A0A0R3Q5W4 | 211-514 | None |
| A0A1I7ZGD4 | 608-873 | None |
| A0A016VZU2 | 262-550 | None |
| A0A7S0ZHU4 | 1-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.