DPCstruct | MC39012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 53.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444XN02 | 1-63 | MAPNPRVTNAYNAMRTLGISDDEVRPVLKRLLKVYGNSWELIEEDNYQTLVHAYFESMEYQVS |
| A0A287JCN0 | 7-62 | NRNSRARRAVKAMKLLGISREQTTPVLKRLVELYDDNWQLIEAESYRVLADAIFDE |
| A0A6V7PJ69 | 1-59 | None |
| A0A4Y7JTW2 | 2-66 | None |
| A0A835GX40 | 1-64 | None |
| A0A835GWV6 | 27-90 | None |
| A0A6A2XZW3 | 1-63 | None |
| A0A6N2LWW4 | 348-421 | None |
| A0A7J8PDQ0 | 1-59 | None |
| A0A067F2M0 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.