DPCstruct | MC3901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 11.06 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 42.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0224 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850R0G3 | 579-678 | QYDRPQARRRYAEVADHLGLSQPGDRTAQKIERLLTWLDELKVNLEIPMSIQAAGVPEADFLAKLDELSVEAFDDQCTGANPRYPLI… |
| A0A1E3S9H5 | 1-116 | MPAPGYSAHIAPDKYAQLGQLIFGGHEPDECRRRLFQWVDDLLVRLNMPRSLREFGVAEEAFLEALPTLAMTAFEDLSNRTNPRMPL… |
| A0A7I7L524 | 58-173 | None |
| R5XNU9 | 525-626 | None |
| A0A378N9T9 | 52-159 | None |
| A0A061RQV4 | 55-167 | None |
| A0A7X7MQB4 | 2-83 | None |
| A0A484X867 | 213-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.