DPCstruct | MC39005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 137 ± 17 aa |
| Standard deviation of domain lengths | 17.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09232 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A454Y2B5 | 24-133 | KIEAVATKCCPKAAFQCCYDAIDFNQRLSCVDILERKRQETIECIQSELHGENDTMTAGIQHIGCCEAFKDDRTDPRSLCYETCKRM… |
| A0A0C2FXP6 | 17-143 | HPTHTLLGTIIIASIVVADVKIDSRQISSRCCPQSRRKCCEEVIEKRQPLNCSMPLHELIASSDCIQKEMFGKKSLELARIEDVECC… |
| A0A7E4W9S5 | 49-219 | None |
| A0A0N4ZZZ0 | 1-143 | None |
| H3E5Z9 | 25-134 | None |
| A0A7E4URD4 | 1-154 | None |
| A0A0K0G2T4 | 38-183 | None |
| H3FIN9 | 10-145 | None |
| H3EIN2 | 8-154 | None |
| A0A1I7SX45 | 1-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.