DPCstruct | MC39001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 169 ± 15 aa |
| Standard deviation of domain lengths | 15.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10783 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P6F358 | 1-150 | MTAYPDGGLAVRDADGTLVGGLSAPTGGGRFTVVSPGRAELRWTTTPAAPQAVAFSLGTRGIVSATWGEREGGRSLAVVPTGWARDA… |
| A0A0Q7M783 | 81-227 | APEGLTIAALTDGTAVVRDGAGAFVAGLTTDPWGSALAQVGPEVVRLDAAADLWFTAVAVESAVWGEAEGGRSLAVTPSAWARARGL… |
| A0A2D9NT20 | 150-316 | None |
| A0A3P1XP49 | 1-161 | None |
| A0A418UR51 | 113-316 | None |
| A0A6B8K864 | 98-272 | None |
| A0A7X7JUG0 | 37-225 | None |
| A0A7C6CEU9 | 19-191 | None |
| A0A4Y8UT42 | 185-355 | None |
| C7NJG9 | 70-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.