DPCstruct | MC39000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 140 ± 21 aa |
| Standard deviation of domain lengths | 21.44 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P6EPI1 | 7-157 | TSVDAADAVLRKLLDEIGDESLLGLDLTVARQGRLDRLPTLEVGLSLKWSLRTDRAQDCRSQGAKMSALRRGRMPHFAVVTMEPRPY… |
| A0A6L3AAZ7 | 190-306 | VAWRDSDALPTLHAAVACKWTIRSDRVQNIRHEAVVLLRHRRGHAPHIVVVTPEPLPSRLASIARGTGEVDCTYHIALDALRKAVAD… |
| A0A2V6CJ09 | 182-301 | None |
| A0A2H5WZS4 | 84-258 | None |
| A0A7X0HFZ8 | 97-257 | None |
| A0A0P6X781 | 177-297 | None |
| A0A7X2PG94 | 117-260 | None |
| A0A7C4RUH0 | 2-157 | None |
| M1RSY4 | 342-449 | None |
| A0A1A2RXB3 | 21-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.