DPCstruct | MC390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 135 ± 25 aa |
| Standard deviation of domain lengths | 25.19 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 93.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11155 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0QHY6 | 6-146 | EEYLHVLSYLKQGKTPPIFHELHHHLIWLVDASGHANAIDARMDGVEKRLKEKSRLFTKHFEQFYLKAVELTGYLRTNIKKFPALQK… |
| A0A151AKT4 | 18-143 | IYSINPIYHHLLWLPDAAGHAGAISDSLDKIEKTLKEISNGFVETFDSMHIRATELYGYMRTGVMEFPALNRLNMDVEKEMTLFKGF… |
| A0A8B4BZ71 | 3-115 | None |
| A0A7Z1BFV9 | 9-135 | None |
| A0A645JUF2 | 1-113 | None |
| T0DRL7 | 69-199 | None |
| A0A2T5UE18 | 17-161 | None |
| A0A7X8MNM5 | 2-153 | None |
| R6L1X9 | 10-141 | None |
| A0A358PX07 | 162-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.