DPCstruct | MC39
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 121 ± 12 aa |
| Standard deviation of domain lengths | 11.52 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15592 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q0U4C1 | 1-113 | MEELEKLLIEEIEANIETTFLYQFHEKNFFDREKFQLLIVNVNKMANYYISNGRTEYYKKIAAGIIDRFEYILCCFYWHLAPNDLCS… |
| A0A3N9UEM9 | 1-128 | MSIAVEVLKSNYEGKEGSFIYSLHEECKFNKSAFWDYYNSIVDLTNETLLQDSLDQELSLMLSTTYVFIMRSLLWHFHPKDMYKVKG… |
| A0A1M6PSU3 | 1-117 | None |
| A0A7W5FS17 | 1-127 | None |
| A0A3D8VEE1 | 1-124 | None |
| R6Z9W1 | 3-93 | None |
| A0A5D0CX57 | 5-127 | None |
| A0A3A9SWR8 | 1-136 | None |
| A0A7G6B1C6 | 3-124 | None |
| A0A358GCF4 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.