DPCstruct | MC38996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 5.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 42.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0IH53 | 97-165 | ASKVRRLGVPILTRYTIVEAKGKESVEGAVIARVDEKFNVVPGTEIEVDVDTICLAVGLTPTAELLFQS |
| A0A7K4CVH5 | 39-104 | DDFGIPLYLSHTVVRVHGKDRVTGITIAKVDDSWKVIPGTEIFFNCDTLLLSVGLIPENEVSKKAG |
| A0A645I7M5 | 1-72 | None |
| A0A7V6J238 | 11-69 | None |
| M7UA88 | 85-141 | None |
| A0A1V6EYP1 | 13-82 | None |
| A0A1V6AFB7 | 6-67 | None |
| A0A497GXD0 | 321-390 | None |
| A0A6B1PJI7 | 59-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.