DPCstruct | MC38995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 165 ± 17 aa |
| Standard deviation of domain lengths | 17.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 13.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0ZKB9 | 11-183 | NTTEDHPDTEDFVNSYLNLIGQIVVSFNSLEKQIKDGIAQLISDDLGMTTRITAGEPFMNLQRLLNVLFRYRVSDRTQLTKLDELNK… |
| A0A192IEP2 | 47-202 | DGFMHALGTAVFAWNDMIECLGILFGGVMYPGSGVPPTAFAVWHSTNSDRIQIETLRAAARVAKRPDGNPLDPDGKIDWLCERAHNL… |
| A0A521Y1S8 | 5-155 | None |
| A0A1Q3PQQ8 | 2-139 | None |
| A0A0D6JFR4 | 55-246 | None |
| A0A4R2IYZ0 | 45-195 | None |
| A0A2K4VZ58 | 34-211 | None |
| A0A7Y0PHJ3 | 9-187 | None |
| A0A563D6M7 | 41-205 | None |
| A0A3A9ZQD8 | 77-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.