DPCstruct | MC38992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 116 ± 27 aa |
| Standard deviation of domain lengths | 26.68 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A542H5D7 | 85-198 | PSLAPVSGKPLHFTLDGTEFAPFHEGTEDPTHAYVRRAEPGIVFGNSDSGVANPARTDGTTLLDEVWAQAPFRGKPALVARVRTVVD… |
| A0A255PTP6 | 1-109 | MTLSAWVKPEHDANRVLDFGDDTTRYLCLAVRNVGGVVLGGRDSGIADPALPDGTTLLDAVGAGAPFRSKGALVARVGKVVDAWIAG… |
| A0A0H4C4Z4 | 27-137 | None |
| A0A6F8Y0F8 | 589-726 | None |
| A0A543KJU3 | 564-643 | None |
| A0A3S9LZR3 | 13-120 | None |
| A0A1R1SBX5 | 77-150 | None |
| A0A286CAZ4 | 272-404 | None |
| A0A7J5UPV8 | 277-355 | None |
| A0A6A5TEA3 | 492-666 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.