DPCstruct | MC38990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 6.25 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A255PHL9 | 38-98 | RLPVGQLAHDARRERRGIVMDHLDGFVWLRPVGGGTEWTALPGDVRPMDVRKQEALLRARV |
| A0A6G4X2F7 | 4-71 | YRRGEAVYDTVRGQPAFVAEADGRWLTLVRPGHRSWRTHEAVVRSADERERATLLALASLVRERRDRE |
| A0A7X1IKN7 | 4-68 | None |
| A0A2V2QNR4 | 4-72 | None |
| A0A1Z1WJ76 | 26-99 | None |
| A0A2L0MWP3 | 2-60 | None |
| A0A1S2KHQ7 | 123-187 | None |
| A0A8A9XTP6 | 3-65 | None |
| A0A0M9YZ12 | 2-57 | None |
| A0A2G1XEJ6 | 13-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.