DPCstruct | MC38988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 160 ± 17 aa |
| Standard deviation of domain lengths | 17.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01341 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2JPQ8 | 4-154 | NVGNPFEAASRWYVNPANVKELDSSIATVSGTIKATLQEMRTMASAYWIDSKAKLRGNGTASLEGILADAAKVSPPALVVVILYDLP… |
| A0A4Q4YTA7 | 1-162 | MKFSNAAVAAFAASAMAAPNKKPRQSALACDSPVRLDASTNVFQQYTLHANNFYRGEVEAAAAQISDPALKEKALKVADVGSFLWLD… |
| A0A7W9HEZ6 | 145-275 | None |
| J7LBA0 | 1-157 | None |
| A0A3N5S7J0 | 395-573 | None |
| A0A0D3MCW9 | 266-439 | None |
| A0A0G4M6F8 | 593-760 | None |
| A0A2A9NZV7 | 57-195 | None |
| A0A6G1I1Q8 | 1-134 | None |
| A0LSH8 | 2-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.