DPCstruct | MC3898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 298 ± 34 aa |
| Standard deviation of domain lengths | 33.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 65.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.53 |
| Pfam Score | 58.33 |
| Assigned Pfam label(s) | PF17780- CL0680- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0DYU9 | 1-291 | MTEYWVSQGNKWCDFCKIYIANNPLSIRTHEIGKRHKDNVTKRLATMQKEGAAKEKEQQQAARALQQIEAKAKKSYQKDLENSQRNV… |
| A0A0B2QZU5 | 1-245 | MTEYWVSQGNKWCDFCKIYISNNPGSIRNHELGQRHKDNVSKRLAAMRKDNIAKEKEQKETARAIEQIEAKAQRSYQKDKAKFEETR… |
| A0A3Q3X6H4 | 1-294 | None |
| A0A7J7N634 | 105-367 | None |
| F0V8M1 | 1-285 | None |
| A0A5E3XN93 | 1-295 | None |
| A0A2R6W498 | 1-299 | None |
| A0A504YPC0 | 1-354 | None |
| U6GYP7 | 1-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.