DPCstruct | MC38979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 209 ± 44 aa |
| Standard deviation of domain lengths | 44.30 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.61 |
| Pfam Score | 48.97 |
| Assigned Pfam label(s) | PF01267- PF01115- CL0224 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V2QTW8 | 22-266 | PGQFDLILADLKIILSSSSPASVENVLSADFIDSIRKEYNLKTSRLILENVNAEEGEEDDAFANALKRAMDSYMLKNFPPNNNTSKT… |
| A0A5K3ERI4 | 23-236 | EHGELGNGRFLCPRSHKSYKLDLYSYSVDDVRPLDPDDGDGGSVELEPWREAIEAALTTYMGKNFPNGAVSVFAPANPKNPELIVYI… |
| B7FXZ8 | 44-205 | None |
| A0A0V0YCD1 | 16-216 | None |
| A0A0G4L6E1 | 22-230 | None |
| A0A0G4L4A5 | 23-251 | None |
| A0A7S4I8V3 | 1-143 | None |
| A0A3M7M2N0 | 66-316 | None |
| A0A485NBU6 | 16-178 | None |
| A0A816PFW4 | 47-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.