DPCstruct | MC38973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 65 ± 11 aa |
| Standard deviation of domain lengths | 10.89 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 61.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822DHD9 | 2-61 | YTPPWYDEERQGLAAGSGVLYKDSRRLNLLPELINAACSILGTWSESTISSTLLHLRSLD |
| A0A815Q8I2 | 1-69 | MILLVCIYIYTPPWYDEELQAFAIGSDILYEDIRRLNLFPELIKATCSVLEAWDKSTLSATLLHLRSLD |
| A0A816GQL5 | 126-194 | None |
| A0A814RC77 | 54-105 | None |
| A0A815RAD8 | 1-69 | None |
| A0A819W0T3 | 12-100 | None |
| A0A819N1F0 | 115-175 | None |
| A0A819LW62 | 2-51 | None |
| A0A814Q8N1 | 142-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.