DPCstruct | MC38970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 110 |
|---|---|
| Mean domain length (aa) | 141 ± 21 aa |
| Standard deviation of domain lengths | 21.47 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 34.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820X4Z3 | 2-118 | RCRHINEVFNETFVQMHVLRRIKYYHLPCQEYSSNLSCFYDVLHICLCYDYEKQRLANCFDFNHNMKFDCLGQSVCENEGECFQDTP… |
| A0A815MN83 | 4-149 | MAFAQILKDYYLIIIHENPIIFEQISTKIISSYRCRSIVELFSNRHILKRVKYYHIPCQKYVELNCFYDEVHICLCTRDRQANCFEF… |
| A0A820TUG1 | 28-193 | None |
| A0A820WMU2 | 62-184 | None |
| A0A819X3W7 | 147-289 | None |
| A0A817QC09 | 327-468 | None |
| A0A816PYJ8 | 79-215 | None |
| A0A821JL53 | 566-685 | None |
| A0A813MKM2 | 538-678 | None |
| A0A813QHF1 | 643-797 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.