DPCstruct | MC38968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 119 ± 16 aa |
| Standard deviation of domain lengths | 15.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815M990 | 13-139 | VVTPHALEDVHVRDELPNDIEMISDDDEQQASNINEQQYEIKKKLTRNQRKNRKKKLKRYFFKVERRVYHKFSITDIKRILINMNIH… |
| A0A815CIG2 | 654-767 | IMNYFHMLIEKKLIISQNQRRSRPALTRRNKKRHEKLRTKQQHHTLIRSISPLWKLHDIKQYLSYYNIQYARLPEIYKHRLRIQFNN… |
| A0A819SZN6 | 1-123 | None |
| A0A819SSK2 | 28-160 | None |
| A0A819SRD7 | 215-338 | None |
| A0A820AWS5 | 192-307 | None |
| A0A822E6Q7 | 310-425 | None |
| A0A814S7R7 | 65-171 | None |
| A0A821Q3E7 | 3-94 | None |
| A0A821Q231 | 133-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.