DPCstruct | MC38964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 128 ± 10 aa |
| Standard deviation of domain lengths | 9.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4R4F2 | 75-201 | MQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDLAHKSHMQSIIDKLQTPASFAQSVQELTIALQRTGDPANLNQL… |
| A0A7J8CTF9 | 1-125 | MQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKTPASFAQSVQELTIALQRTGDPANLNRLRP… |
| A0A0S7GAY0 | 942-1055 | None |
| A0A815HYF7 | 52-198 | None |
| A0A1D1W8J8 | 243-380 | None |
| A0A132A6X2 | 115-242 | None |
| A0A820X970 | 1-122 | None |
| A0A818CI51 | 130-255 | None |
| A0A1P6C3I9 | 261-407 | None |
| A0A2J7Q7W9 | 135-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.