DPCstruct | MC38960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 314 |
|---|---|
| Mean domain length (aa) | 265 ± 68 aa |
| Standard deviation of domain lengths | 67.53 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 89.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.18 |
| Pfam Score | 99.18 |
| Assigned Pfam label(s) | PF14904- CL0072- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R5EWQ1 | 87-362 | SYGAWSKDFARGPMQDWLSTEAAKYMLRHKQPNLLLLHYLLPDSLQHQYGACSPELAWAAGYIDERIGDLLKTLKELGLEENTELFI… |
| A0A2K5M4J5 | 3-217 | SHEVIKALQRVDNMVGMLMDGLKELNLHRCLNLILVSDHGMEQGSCKKYIYLNKYLGDVKNIKVIYGPAARLRPSDVPDKYYSFNYE… |
| A0A5J4Z887 | 245-555 | None |
| A0A838RDQ4 | 142-401 | None |
| A0A498NCZ2 | 495-759 | None |
| A0A0N4W9Q2 | 128-446 | None |
| A0A4Q2QTF9 | 14-197 | None |
| A0A7V1KN76 | 40-298 | None |
| A0A836AIK2 | 16-244 | None |
| A0A7R9A780 | 55-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.