DPCstruct | MC3896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 9.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06522 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151MQ98 | 7-82 | RHARRHPSLLPLFLFIGCGGVGAALYLLRLAVSSPDVCWDKKNNPEPWNKLGPTDQYKFFAINVDYSKLKKERPDF |
| R7VMU8 | 2-68 | IPLIGFISVGLGSAVLYLARLALYSPDVSWDRKNNPEPWNKLSPTDQYKFLAVSTDYKSLKKERPSF |
| A0A6P8Z5X8 | 34-108 | None |
| T1H6Z9 | 1-78 | None |
| A0A151PJU9 | 80-146 | None |
| A0A212ELZ2 | 1-83 | None |
| S7PH97 | 16-82 | None |
| T2MIV0 | 4-76 | None |
| E3KSH8 | 77-170 | None |
| A0A4X2LU08 | 6-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.