DPCstruct | MC38957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 96 ± 14 aa |
| Standard deviation of domain lengths | 13.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12395 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A531Z462 | 413-498 | LRIVGDQGLQSAPMTHFDDVIASQVTSEWRNGARVVAQSLGAILDQGFWQCGDLVLWSAVRRLVDEGVFEMKGDGMVMRENHVRLP |
| A0A559J0X5 | 16-97 | IQYTVNGKLTAVLVDYYDVFLLEHVTDDYQLAARVVGAVMGDSNLVVGDMYLAFGVRQLIDEGKLDYRGELGSLRDYEIRLK |
| A0A7T9JU52 | 4-77 | None |
| A0A069RFT5 | 172-265 | None |
| A0A525IKZ4 | 2-76 | None |
| A0A1I1PF80 | 40-155 | None |
| A0A7C6JS79 | 88-188 | None |
| A0A4Q5UC17 | 6-98 | None |
| A0A3C0REE1 | 1-83 | None |
| A0A0R0D7K3 | 19-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.