DPCstruct | MC38952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 127 ± 9 aa |
| Standard deviation of domain lengths | 8.95 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 35.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A355B2C6 | 1-116 | MPDPIINPAALEPLFGPSEIPNQHRVPGKKRGDSAQTIKGRRPSRITIAQILRREVAEWREAQYGGASDTSRELLFHWFGIDHQVPT… |
| A0A2K8U7R8 | 5-131 | FVDRPILNSPYACPARHWELDDRGQPTRKTLETRRCADFITPIPKPRKQQGAPKQGELLFDDGKGLSTQTQRYDRTAVINAVRRKVD… |
| A0A1F7LSD9 | 3-137 | None |
| A0A354EDE9 | 1-131 | None |
| A0A0B0EEH8 | 3-112 | None |
| A0A0J6VIH7 | 2-118 | None |
| A0A1J5IBH9 | 15-133 | None |
| A0A1V4XVZ0 | 2-115 | None |
| A0A0E3B079 | 1-136 | None |
| A0A174CCJ7 | 5-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.