DPCstruct | MC3895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 95 ± 9 aa |
| Standard deviation of domain lengths | 8.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7D9P1 | 1-88 | MSKTDVQETPPTPDQLTSILDYLGPSKAGSVVEEATGTSDALRKFNAKQQAFQRPVTVDWNNGRAVVGDDESELMRLVRTLPKETDQV |
| A0A3M7IJX2 | 1-101 | MTAQESYLPDSADIFNLDVQETPPTPDQLTSILDYLGPSKAGTVVEEATGTSDALRKFNAKQQSFQRPVTVDWNNGRAVVGDDESEL… |
| A0A367L2T4 | 448-535 | None |
| A0A2I2FEG8 | 297-396 | None |
| A0A4V5NEA1 | 357-437 | None |
| A0A1F5L6F8 | 281-388 | None |
| A0A4S8TV97 | 191-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.