DPCstruct | MC38947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 177 |
|---|---|
| Mean domain length (aa) | 127 ± 26 aa |
| Standard deviation of domain lengths | 25.90 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 11.66 |
| Pfam Score | 25.45 |
| Assigned Pfam label(s) | PF10665- PF20557- CL0504- PF19586 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9H5T9 | 9-146 | IRKVIYRLKRSYGLPIDYYQLATHTMDPEDGDKVTTLIKTHIRRAVVLRARGFRSFVYDLAFISANKDFTEGGYFDPEDRKVIIDTR… |
| T0Q928 | 2-96 | EFELLRKGKIKVINGIEHYEPDRSFKPIGIKTDYKANEIDGKLILAGDIRIVFTGETEIKLGDIVTVDNDKYRVVNNNPSKPAETLI… |
| A0A2G1LV00 | 8-122 | None |
| A0A4R1IPC6 | 564-675 | None |
| A0A142WUE1 | 105-216 | None |
| D4CXM8 | 2-148 | None |
| A0A2D5F6G5 | 5-150 | None |
| A0A401FPL2 | 1-123 | None |
| A0A356FZ75 | 4-126 | None |
| A0A3D1PXX2 | 2-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.