DPCstruct | MC38943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 179 |
|---|---|
| Mean domain length (aa) | 123 ± 21 aa |
| Standard deviation of domain lengths | 20.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 12.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9H0A4 | 40-152 | GVKIGWSSRDAGGDQVITGVGYQSSLIIFLAADTPYSNRNWSVGFDDGAVAMSVLNHENGTLTGVKIGESIAIDRVLANQLMGHVTA… |
| A0A2K4KL22 | 94-234 | ASGQFSVAGDAQAGKMVLRRKTTDATPTVLTSDGVAGSSTNQVILPDYSTFTFRIQVVAMQKVGDGSKTAGYEFTGVIRRGPGAAST… |
| A0A3D2ICN6 | 141-279 | None |
| A0A2G5W4W2 | 249-361 | None |
| A0A2U1JTZ1 | 235-383 | None |
| A0A1M5FCQ8 | 608-755 | None |
| A0A5B0W265 | 132-236 | None |
| A0A4R2LT83 | 35-150 | None |
| X6GKG9 | 500-631 | None |
| A0A7W1C1R3 | 970-1105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.