DPCstruct | MC38939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 118 ± 15 aa |
| Standard deviation of domain lengths | 14.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13798 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q5P6L0 | 24-162 | GVHDNHEGHTQVAPNGDLQEATASITDLPAFLDDKDENMRAIYLAAAKHADVIQQMPCYCGCGDSAGHMSNLNCFIAEKSENEVVWD… |
| A0A1F8LXB8 | 1-106 | MASLDGMPAEVKAAPISVQQAYQFAIAYPEIMKQIPCYCGCGAMGHTSNYACYVSDVDANGTVSYDTHALGCSICVDITQDTMRLLK… |
| A0A317IND0 | 21-144 | None |
| A0A522T9I3 | 17-129 | None |
| A0A854DWS0 | 13-125 | None |
| B6EWU8 | 172-320 | None |
| A0A812XR35 | 163-295 | None |
| A0A2V9ZW13 | 4-111 | None |
| A0A0B3AL61 | 25-125 | None |
| A0A2V7WMU3 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.