DPCstruct | MC38933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 102 ± 12 aa |
| Standard deviation of domain lengths | 12.49 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 94.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 60.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08354 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8F2H4 | 146-262 | VIRIATEVPTKPVIMHVEGGRAGGHHSWEDLDDLLLATYSELRSRANITVCVGGGIGTPERAAEYLSGRWAQAYGFPLMPIDGILVG… |
| A0A409Y503 | 50-152 | QVINIAAANPDFPIIMQWTGGHAGGHHSFEDFHQPVLATYRAIRQHPNICLVGGSGSGSAEDVWEYLTGDWSVQRFGVQPMPFDGFL… |
| A0A7G1I707 | 247-324 | None |
| A0A1V3XPQ1 | 106-185 | None |
| A0A109FHW6 | 673-777 | None |
| A0A0G4N7H7 | 121-203 | None |
| R4MAY1 | 156-272 | None |
| A0A2S8BGH0 | 76-190 | None |
| M2XHU6 | 579-678 | None |
| A0A316VXX6 | 811-922 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.