DPCstruct | MC3893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 5.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E6YGA7 | 82-150 | NLRDIIAILDPNPAASKGASAPKQRKARVLKVYQNPHTGELIETKGGNHRGLKAWKEEYGAATVDTWLR |
| A0A3A6R0Q2 | 341-404 | EIPESGKQGASVPPVKRARRARTTQIYKNPHNGEMVETKSGNHKILKAWKGEYGGDVVKSWLVQ |
| A0A3M5YKB8 | 21-92 | None |
| A0A1Q8G2M1 | 178-238 | None |
| A0A3M5AMN1 | 904-976 | None |
| A0A1W6KG04 | 148-205 | None |
| A0A3G7TLL6 | 20-90 | None |
| A0A656H521 | 7-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.