DPCstruct | MC38929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 158 ± 15 aa |
| Standard deviation of domain lengths | 15.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q4N8W3 | 17-157 | QDAQQRIAAGQWEEALTLWVQQASPRALSLWLIRILRGSAQPAAASLLDEMQRWYAEPDEKLRWQIFHHADTLGFETPVGALALSLF… |
| L0DBF9 | 23-187 | LGEASRELLRTDPTAKQFLNLLIEKQEFPDAARFWAHALPKREAVWWACVCARLVMADGAPLPQHAALDAAEAWCTDPTEENRRKTM… |
| A0A747XGJ5 | 5-158 | None |
| A0A0Q5PR56 | 10-186 | None |
| A0A5Y0S532 | 1-134 | None |
| A0A3D4VCY9 | 10-194 | None |
| A0A6G1A3B3 | 17-180 | None |
| A0A3B0LYB1 | 5-132 | None |
| A0A2W4MT04 | 5-148 | None |
| A0A5K7ZKR3 | 17-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.