DPCstruct | MC38928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 114 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q4MRZ0 | 223-316 | LVPKGQLTFDAEGNDIESSPWFSRRVHWPGGVSGITIGRGYDLGQNNSSNNELTEVGVDENLKSWLVGSQSMSGATASTRLNGAPTS… |
| A0A4R3VHL2 | 1-115 | MLRVPQGQITFDGEGDDSPNSPYFSRVIHWPGNPKSGVTLGRGYDMGGRTKGEVYSDMLRIGIGSEKASLIAMGASLKGAAAAIFVK… |
| A0A1I3LN83 | 266-382 | None |
| A0A6S7IGV7 | 314-406 | None |
| A0A521H295 | 538-663 | None |
| A0A1H1LQD9 | 745-864 | None |
| A0A0C9NB98 | 5-92 | None |
| A0A519FXE3 | 50-163 | None |
| A0A1C4CVR3 | 16-126 | None |
| A0A3R8T9C0 | 278-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.