DPCstruct | MC38927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 202 ± 34 aa |
| Standard deviation of domain lengths | 33.91 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q4MRZ0 | 30-214 | HYLLPAPDNGYVAASSVDVLSQFDLGKLGFCIIKDDPDSFQLLDAENQPQNVVKGIFEKLKAAAEDDPAFSNALASHKYKQLLDVID… |
| A0A4R6E9W9 | 470-702 | NPLYLKYSPGLALFTKDVAAGTFMKGKMTERTGILKLSQVTTEADKTTKQEYWQLRPENAYASKGQAEPQLLSQYDLAKLGFRTETA… |
| A0A443TYM3 | 16-185 | None |
| A0A7W5P239 | 81-214 | None |
| A0A3S8ZTR4 | 241-375 | None |
| A0A808WE61 | 354-515 | None |
| A0A0W0LK12 | 32-221 | None |
| A0A2Z6U981 | 1-172 | None |
| A0A7Z0Y1Z4 | 160-372 | None |
| A0A659L0E6 | 374-561 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.