DPCstruct | MC38925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 8.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A081B0C0 | 2-80 | NATKIEIRWLVSWFRSFASTLGDVVPVRVRTQKTIDGNVRKQYMDENYTLLPAYFTWDQLYTEMNAYVLENDLDVREPA |
| A0A6A4D7M3 | 263-341 | NASKIDIRWLAQWFRGFAATLGDVVPVRVRSQETIDGVVRKRYSAEDYTLLPAFFTWDQLYTEMQNYVAENEMDVRMPQ |
| A0A2P4WZS1 | 7-96 | None |
| A0A6A3S854 | 145-242 | None |
| A0A329RQB4 | 122-212 | None |
| A0A6G0QY32 | 81-172 | None |
| A0A6A3NWQ4 | 80-173 | None |
| A0A6A3NIS8 | 5-83 | None |
| A0A6G0RV12 | 24-115 | None |
| W2HX76 | 3-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.