DPCstruct | MC38921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 93 ± 17 aa |
| Standard deviation of domain lengths | 16.61 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4NC37 | 1-85 | MDGGVLYDIGNWIHTSLTPEFDLDTSKKEKSGLFVEDLDLILHYHFVRDEELYTHERLRVQLALILIIAGATATRPDALIVGIPL |
| A0A0J8RYT2 | 72-152 | DDIVGEQISEFILGPLTDEYNLDLSVKSKPTMSVEDLLSILHYHWCLDTSPVPHERYTVQLLLLMLMTAYTSSRPGALIES |
| G2YHL9 | 15-93 | None |
| A0A2S7QX48 | 1-78 | None |
| J4UF96 | 146-217 | None |
| A0A0A1SXQ7 | 39-147 | None |
| A0A0F7ZWB8 | 44-161 | None |
| A0A094K4K5 | 55-152 | None |
| A0A2J6T8I8 | 1-85 | None |
| A0A1B8DL51 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.