DPCstruct | MC38920
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 203 ± 18 aa |
| Standard deviation of domain lengths | 18.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0141 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3UPV7 | 28-219 | ENGPLEDSSDFAFVDEMNWFEILLGIAIIFFSFVCFVPQIYKILKRRDGSGLSPSFLLILAFNQVFAVINATITNSPTMHSCTVIGW… |
| A0A0G4N2H7 | 1-187 | MDSAAAFSPTMAVPAFFQTKDRCEELRSPNYFNLSLSLLILLGLLISYLPQHHRIASRRTSEGISPWFVLLGVTSATSGFANILTVP… |
| A0A015KXG5 | 1-221 | None |
| A0A2P6NGA6 | 204-379 | None |
| A0A4Y9XUS8 | 3-218 | None |
| A0A1S8VR91 | 2-213 | None |
| W7EL65 | 5-196 | None |
| A0A1S9S2N8 | 109-288 | None |
| A0A3M6YNS7 | 18-203 | None |
| A0A1L7TM42 | 182-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.