DPCstruct | MC3892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 98 ± 18 aa |
| Standard deviation of domain lengths | 17.99 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.58 |
| Pfam Score | 94.87 |
| Assigned Pfam label(s) | PF20632- CL0687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0E4Y8 | 113-182 | VCIFCKKEANWRCLDCFAGTAYCAECCRTSHCRDPFHWIERWTGTFYEPSWLWKVGLVIRLGHEGDRCPN |
| A0A0C3D611 | 112-225 | FLDELLRLEGRGDYASQVACISCKAGAPLFQCKDCWCMELYCSDCCIELHLRLPFHHVEQWVDMHFTRVTLKSLGLRLQLGHTVGDH… |
| A0A6A4GPN4 | 187-298 | None |
| A0A6A4GWH4 | 332-446 | None |
| A0A2H3CJ32 | 222-337 | None |
| A0A6A4GLA6 | 164-274 | None |
| V2WUB5 | 13-111 | None |
| A0A4Y9YXF6 | 341-451 | None |
| A0A6A4H118 | 7-90 | None |
| A0A0H2R7E6 | 78-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.