DPCstruct | MC38918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 170 ± 21 aa |
| Standard deviation of domain lengths | 20.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7QT88 | 5-172 | LVHLPNGHNMTVNPVFGGFFFKANELNTHTNVFPAGWTVIIQTEDDCDEHQSSSDVNDERTAPKARHRHIHPFKIPTLHNDSLFISS… |
| A0A0G4MV77 | 1-181 | MAPPTMLHLPDGQNFTVTPVFSGLFFKSHERNTHHNAFPIGWTVVLNTEDNLAPGETADPDDEDERIRRRRIHAWKKPTLQNDNLFI… |
| A0A225APW9 | 5-167 | None |
| F0X7S8 | 421-627 | None |
| A0A179FJ56 | 1-194 | None |
| A0A3M7D3J5 | 3-200 | None |
| A0A2C5XUG4 | 1-162 | None |
| A0A1L9TSP6 | 2-161 | None |
| F9FL14 | 1-177 | None |
| A0A395MFZ1 | 3-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.