DPCstruct | MC38911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 345 ± 61 aa |
| Standard deviation of domain lengths | 61.27 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.88 |
| Pfam Score | 83.96 |
| Assigned Pfam label(s) | CL0041- PF20028- PF19963- PF19916 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H1W8U4 | 333-700 | EIKSLLKSSIILPVPGMFEDRKPMNFEGISQQILQILQGIGYDKDVVEFAQTALPDDAIVEDTFLPSELSSLTQILRYQCLDKFLNL… |
| A0A2W4WUB6 | 1-198 | MECEKDPEFYVFLPKELLDTAVDQWPLTSSGCLGHTYSVVLCCSDRIDYPTASIGGWQRYWKRHENAAGQTARDVFIECDGRDMSAV… |
| A0A7K2JYI3 | 16-296 | None |
| A0A810LG20 | 502-850 | None |
| A0A3G9K2Y3 | 41-391 | None |
| A0A6G3D4L1 | 261-632 | None |
| A0A4R7A9D9 | 202-547 | None |
| A0A6N6WK51 | 181-529 | None |
| A0A367F2X8 | 663-1008 | None |
| A0A3N1L4R5 | 108-573 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.